PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48417.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 471aa    MW: 52480.6 Da    PI: 8.7435
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48417.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.6e-101692061954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  KHN48417.1 169 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 206
                 664459******************************88 PP

2BELL121.92.7e-3933104172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqe+q+kkakL+++l+eV++rY+qy++q+++vissFe++ag+gsa+ Yt+lAl++iS++FrcLkdai++qi
  KHN48417.1  33 ERQEIQIKKAKLINMLDEVEQRYRQYHNQMKIVISSFEQAAGIGSARTYTALALQTISKQFRCLKDAITGQI 104
                 79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-341102IPR006563POX domain
PfamPF075261.9E-377101IPR006563POX domain
PROSITE profilePS5007112.195147210IPR001356Homeobox domain
SMARTSM003895.3E-9150214IPR001356Homeobox domain
CDDcd000862.47E-11150211No hitNo description
SuperFamilySSF466894.71E-17151217IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-29153216IPR009057Homeodomain-like
PfamPF059201.8E-18167206IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
TKVVGESSTA ASGDGSVGGE GSGKRSSELS TTERQEIQIK KAKLINMLDE VEQRYRQYHN  60
QMKIVISSFE QAAGIGSART YTALALQTIS KQFRCLKDAI TGQIRAANKS LGEEDCFGAK  120
IEGSRLKYVD HHLRQQRAIQ QLGMIHHNAW RPQRGLPERS VSVLRAWLFE HFLHPYPKDS  180
DKHMLAKQTG LTRSQVSNWF INARVRLWKP MVEEMYLEEM KEHELNGSEE KSSKSGEDPA  240
TKTTSPQEKR TSSEIESKSF NSKQDVSKQS QNTPILPTSP PSISPIGGSV KNQSGFSFMG  300
SSELDGITQG SPKKPRNHEI LHSPNRVPSI NMDVKANEAN NEQQLSMDHE RQNNRDSYSF  360
MGNQTNFISG FGQYPIEEIG RFDAEQFTPR FSGKNGVSLT LGLPHCDTLS GTHQSFLPNQ  420
NIQLGRGLDI GEPNQFGALN NSNSHNSAAF ESINMQNPKR FAAQLLPDFV A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16156214563Homeobox protein Meis2
3k2a_B2e-16156214563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311670.0KT031167.1 Glycine max clone HN_CCL_176 homeodomain/HOMEOBOX transcription factor (Glyma10g10040.2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535815.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_006588872.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_014618534.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_014618535.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_014618536.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-145BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0K2CTJ90.0A0A0K2CTJ9_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLA0A0B2SVY00.0A0A0B2SVY0_GLYSO; BEL1-like homeodomain protein 1 (Fragment)
TrEMBLI1L9K60.0I1L9K6_SOYBN; Uncharacterized protein
STRINGGLYMA10G10040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-139BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]